TCERG1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14850
Artikelname: TCERG1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14850
Hersteller Artikelnummer: A14850
Alternativnummer: ABB-A14850-100UL,ABB-A14850-20UL,ABB-A14850-1000UL,ABB-A14850-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Urn1, CA150, TAF2S, TCERG1
This gene encodes a nuclear protein that regulates transcriptional elongation and pre-mRNA splicing. The encoded protein interacts with the hyperphosphorylated C-terminal domain of RNA polymerase II via multiple FF domains, and with the pre-mRNA splicing factor SF1 via a WW domain. Alternative splicing results in multiple transcripts variants encoding different isoforms.
Klonalität: Polyclonal
Molekulargewicht: 124kDa
NCBI: 10915
UniProt: O14776
Reinheit: Affinity purification
Sequenz: TTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKA
Target-Kategorie: TCERG1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Tumor biomarkers. Shipping: Ice Bag
Western blot analysis of various lysates using TCERG1 Rabbit pAb (A14850) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.