TCERG1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14850
Article Name: TCERG1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14850
Supplier Catalog Number: A14850
Alternative Catalog Number: ABB-A14850-100UL,ABB-A14850-20UL,ABB-A14850-1000UL,ABB-A14850-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Urn1, CA150, TAF2S, TCERG1
This gene encodes a nuclear protein that regulates transcriptional elongation and pre-mRNA splicing. The encoded protein interacts with the hyperphosphorylated C-terminal domain of RNA polymerase II via multiple FF domains, and with the pre-mRNA splicing factor SF1 via a WW domain. Alternative splicing results in multiple transcripts variants encoding different isoforms.
Clonality: Polyclonal
Molecular Weight: 124kDa
NCBI: 10915
UniProt: O14776
Purity: Affinity purification
Sequence: TTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKA
Target: TCERG1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Tumor biomarkers. Shipping: Ice Bag
Western blot analysis of various lysates using TCERG1 Rabbit pAb (A14850) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.