GABARAPL2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14855
Artikelname: GABARAPL2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14855
Hersteller Artikelnummer: A14855
Alternativnummer: ABB-A14855-100UL,ABB-A14855-20UL,ABB-A14855-500UL,ABB-A14855-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ATG8, GEF2, ATG8C, GEF-2, GATE16, GATE-16, GABARAPL2
Enables ubiquitin protein ligase binding activity. Involved in negative regulation of proteasomal protein catabolic process and protein localization to endoplasmic reticulum. Located in Golgi membrane and autophagosome membrane.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 11345
UniProt: P60520
Reinheit: Affinity purification
Sequenz: MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYL
Target-Kategorie: GABARAPL2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using GABARAPL2 Rabbit pAb (A14855) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.