GABARAPL2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14855
Article Name: GABARAPL2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14855
Supplier Catalog Number: A14855
Alternative Catalog Number: ABB-A14855-100UL,ABB-A14855-20UL,ABB-A14855-500UL,ABB-A14855-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ATG8, GEF2, ATG8C, GEF-2, GATE16, GATE-16, GABARAPL2
Enables ubiquitin protein ligase binding activity. Involved in negative regulation of proteasomal protein catabolic process and protein localization to endoplasmic reticulum. Located in Golgi membrane and autophagosome membrane.
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 11345
UniProt: P60520
Purity: Affinity purification
Sequence: MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYL
Target: GABARAPL2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using GABARAPL2 Rabbit pAb (A14855) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.