ATRNL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14868
Artikelname: ATRNL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14868
Hersteller Artikelnummer: A14868
Alternativnummer: ABB-A14868-100UL,ABB-A14868-20UL,ABB-A14868-500UL,ABB-A14868-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ALP, bA338L11.1, bA454H24.1, ATRNL1
Predicted to enable carbohydrate binding activity. Predicted to be involved in several processes, including animal organ morphogenesis, cell migration, and substrate adhesion-dependent cell spreading. Predicted to act upstream of or within G protein-coupled receptor signaling pathway. Predicted to be located in membrane. Predicted to be integral component of membrane. Predicted to be active in basement membrane.
Klonalität: Polyclonal
Molekulargewicht: 153kDa
NCBI: 26033
UniProt: Q5VV63
Reinheit: Affinity purification
Sequenz: LYAQVSQSKPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLI
Target-Kategorie: ATRNL1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from mouse liver, using ATRNL1 Rabbit pAb (A14868) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.