ATRNL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14868
Article Name: ATRNL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14868
Supplier Catalog Number: A14868
Alternative Catalog Number: ABB-A14868-100UL,ABB-A14868-20UL,ABB-A14868-500UL,ABB-A14868-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ALP, bA338L11.1, bA454H24.1, ATRNL1
Predicted to enable carbohydrate binding activity. Predicted to be involved in several processes, including animal organ morphogenesis, cell migration, and substrate adhesion-dependent cell spreading. Predicted to act upstream of or within G protein-coupled receptor signaling pathway. Predicted to be located in membrane. Predicted to be integral component of membrane. Predicted to be active in basement membrane.
Clonality: Polyclonal
Molecular Weight: 153kDa
NCBI: 26033
UniProt: Q5VV63
Purity: Affinity purification
Sequence: LYAQVSQSKPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLI
Target: ATRNL1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from mouse liver, using ATRNL1 Rabbit pAb (A14868) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.