DEXI Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14879
Artikelname: DEXI Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14879
Hersteller Artikelnummer: A14879
Alternativnummer: ABB-A14879-20UL,ABB-A14879-100UL,ABB-A14879-500UL,ABB-A14879-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MYLE, DEXI
DEXI (Dexi Homolog) is a Protein Coding gene. Diseases associated with DEXI include Fibrosclerosis Of Breast and Immunoglobulin A Deficiency 1.
Klonalität: Polyclonal
Molekulargewicht: 10kDa
NCBI: 28955
UniProt: O95424
Reinheit: Affinity purification
Sequenz: MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
Target-Kategorie: DEXI
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using DEXI Rabbit pAb (A14879) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.