DEXI Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14879
Article Name: DEXI Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14879
Supplier Catalog Number: A14879
Alternative Catalog Number: ABB-A14879-20UL,ABB-A14879-100UL,ABB-A14879-500UL,ABB-A14879-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MYLE, DEXI
DEXI (Dexi Homolog) is a Protein Coding gene. Diseases associated with DEXI include Fibrosclerosis Of Breast and Immunoglobulin A Deficiency 1.
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 28955
UniProt: O95424
Purity: Affinity purification
Sequence: MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
Target: DEXI
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using DEXI Rabbit pAb (A14879) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.