POT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1491
- Bilder (1)
| Artikelname: | POT1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1491 |
| Hersteller Artikelnummer: | A1491 |
| Alternativnummer: | ABB-A1491-100UL,ABB-A1491-20UL,ABB-A1491-1000UL,ABB-A1491-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GLM9, CMM10, HPOT1, POT1 |
| This gene is a member of the telombin family and encodes a nuclear protein involved in telomere maintenance. Specifically, this protein functions as a member of a multi-protein complex that binds to the TTAGGG repeats of telomeres, regulating telomere length and protecting chromosome ends from illegitimate recombination, catastrophic chromosome instability, and abnormal chromosome segregation. Increased transcriptional expression of this gene is associated with stomach carcinogenesis and its progression. Alternatively spliced transcript variants have been described. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 71kDa |
| NCBI: | 25913 |
| UniProt: | Q9NUX5 |
| Reinheit: | Affinity purification |
| Sequenz: | TIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI |
| Target-Kategorie: | POT1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G2 M DNA Damage Checkpoint. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using POT1 Rabbit pAb (A1491) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
