POT1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1491
Article Name: POT1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1491
Supplier Catalog Number: A1491
Alternative Catalog Number: ABB-A1491-100UL,ABB-A1491-20UL,ABB-A1491-1000UL,ABB-A1491-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GLM9, CMM10, HPOT1, POT1
This gene is a member of the telombin family and encodes a nuclear protein involved in telomere maintenance. Specifically, this protein functions as a member of a multi-protein complex that binds to the TTAGGG repeats of telomeres, regulating telomere length and protecting chromosome ends from illegitimate recombination, catastrophic chromosome instability, and abnormal chromosome segregation. Increased transcriptional expression of this gene is associated with stomach carcinogenesis and its progression. Alternatively spliced transcript variants have been described.
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 25913
UniProt: Q9NUX5
Purity: Affinity purification
Sequence: TIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQYVFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAYPWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI
Target: POT1
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G2 M DNA Damage Checkpoint. Shipping: Ice Bag
Western blot analysis of various lysates using POT1 Rabbit pAb (A1491) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.