GluR4/GluA4/GRIA4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1492
- Bilder (1)
| Artikelname: | GluR4/GluA4/GRIA4 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1492 |
| Hersteller Artikelnummer: | A1492 |
| Alternativnummer: | ABB-A1492-20UL,ABB-A1492-100UL,ABB-A1492-1000UL,ABB-A1492-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GLUR4, GLURD, GluA4, GLUR4C, NEDSGA, GluA4-ATD, GluR4/GluA4/GRIA4 |
| Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate)-sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA, R->G). Alternative splicing of this gene results in transcript variants encoding different isoforms, which may vary in their signal transduction properties. Some haplotypes of this gene show a positive association with schizophrenia. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 101kDa |
| NCBI: | 2893 |
| UniProt: | P48058 |
| Reinheit: | Affinity purification |
| Sequenz: | HGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMPLMKNPILRN |
| Target-Kategorie: | GRIA4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag |

