GluR4/GluA4/GRIA4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1492
Article Name: GluR4/GluA4/GRIA4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1492
Supplier Catalog Number: A1492
Alternative Catalog Number: ABB-A1492-20UL,ABB-A1492-100UL,ABB-A1492-1000UL,ABB-A1492-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GLUR4, GLURD, GluA4, GLUR4C, NEDSGA, GluA4-ATD, GluR4/GluA4/GRIA4
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate)-sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA, R->G). Alternative splicing of this gene results in transcript variants encoding different isoforms, which may vary in their signal transduction properties. Some haplotypes of this gene show a positive association with schizophrenia.
Clonality: Polyclonal
Molecular Weight: 101kDa
NCBI: 2893
UniProt: P48058
Purity: Affinity purification
Sequence: HGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMPLMKNPILRN
Target: GRIA4
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag
Western blot analysis of various lysates using GluR4/GluA4/GRIA4 Rabbit pAb (A1492) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.