KCNU1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14967
- Bilder (1)
| Artikelname: | KCNU1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14967 |
| Hersteller Artikelnummer: | A14967 |
| Alternativnummer: | ABB-A14967-100UL,ABB-A14967-20UL,ABB-A14967-1000UL,ABB-A14967-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KCa5, Slo3, KCNMC1, KCa5.1, Kcnma3, SPGF79, KCNU1 |
| This gene encodes a member of the potassium channel family of proteins. The encoded voltage-gated ion channel allows the outward flow of potassium ions during plasma membrane hyperpolarization in sperm. Opening of this channel may be regulated by calcium ion levels. Homozygous knockout mice that lack the related mouse gene exhibit male sterility. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 130kDa |
| NCBI: | 157855 |
| UniProt: | A8MYU2 |
| Reinheit: | Affinity purification |
| Sequenz: | LELLQMLVTGGVSSQLEQHLDKDKVYGVADSCTSLLSGRNRCKLGLLSLHETILSDVNPRNTFGQLFCGSLDLFGILCVGLYRIIDEEELNPENKRFVITRPANEFKLLPSDLVFCAIPFSTACYKRNEEFSLQKSYEIVNKASQTTETHSDTNCPPTIDSVTETLYSPVYSYQPRTNSLSFPKQIAWNQSRTNSIISSQIPLGDNAKENERKTSDEVYDEDPFAYSEPL |
| Target-Kategorie: | KCNU1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Rat. ResearchArea: Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from rat testis, using KCNU1 Rabbit pAb (A14967) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
