KCNU1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14967
- Images (1)
| Article Name: | KCNU1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14967 |
| Supplier Catalog Number: | A14967 |
| Alternative Catalog Number: | ABB-A14967-100UL,ABB-A14967-20UL,ABB-A14967-1000UL,ABB-A14967-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | KCa5, Slo3, KCNMC1, KCa5.1, Kcnma3, SPGF79, KCNU1 |
| This gene encodes a member of the potassium channel family of proteins. The encoded voltage-gated ion channel allows the outward flow of potassium ions during plasma membrane hyperpolarization in sperm. Opening of this channel may be regulated by calcium ion levels. Homozygous knockout mice that lack the related mouse gene exhibit male sterility. Alternative splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 130kDa |
| NCBI: | 157855 |
| UniProt: | A8MYU2 |
| Purity: | Affinity purification |
| Sequence: | LELLQMLVTGGVSSQLEQHLDKDKVYGVADSCTSLLSGRNRCKLGLLSLHETILSDVNPRNTFGQLFCGSLDLFGILCVGLYRIIDEEELNPENKRFVITRPANEFKLLPSDLVFCAIPFSTACYKRNEEFSLQKSYEIVNKASQTTETHSDTNCPPTIDSVTETLYSPVYSYQPRTNSLSFPKQIAWNQSRTNSIISSQIPLGDNAKENERKTSDEVYDEDPFAYSEPL |
| Target: | KCNU1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Rat. ResearchArea: Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from rat testis, using KCNU1 Rabbit pAb (A14967) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s. |
Product Guarantee and Expert Support
