UNC5B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14978
Artikelname: UNC5B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14978
Hersteller Artikelnummer: A14978
Alternativnummer: ABB-A14978-20UL,ABB-A14978-100UL,ABB-A14978-500UL,ABB-A14978-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: UNC5H2, p53RDL1, UNC5B
This gene encodes a member of the netrin family of receptors. This particular protein mediates the repulsive effect of netrin-1 and is a vascular netrin receptor. This encoded protein is also in a group of proteins called dependence receptors (DpRs) which are involved in pro- and anti-apoptotic processes. Many DpRs are involved in embryogenesis and in cancer progression. Two alternatively spliced transcript variants have been described for this gene.
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 219699
UniProt: Q8IZJ1
Reinheit: Affinity purification
Sequenz: FQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLSDPNSHLLEASGDAALY
Target-Kategorie: UNC5B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Apoptosis,Neuroscience,Cardiovascular. Shipping: Ice Bag
Western blot analysis of various lysates using UNC5B Rabbit pAb (A14978) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.