UNC5B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14978
Article Name: UNC5B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14978
Supplier Catalog Number: A14978
Alternative Catalog Number: ABB-A14978-20UL,ABB-A14978-100UL,ABB-A14978-500UL,ABB-A14978-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: UNC5H2, p53RDL1, UNC5B
This gene encodes a member of the netrin family of receptors. This particular protein mediates the repulsive effect of netrin-1 and is a vascular netrin receptor. This encoded protein is also in a group of proteins called dependence receptors (DpRs) which are involved in pro- and anti-apoptotic processes. Many DpRs are involved in embryogenesis and in cancer progression. Two alternatively spliced transcript variants have been described for this gene.
Clonality: Polyclonal
Molecular Weight: 104kDa
NCBI: 219699
UniProt: Q8IZJ1
Purity: Affinity purification
Sequence: FQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLSDPNSHLLEASGDAALY
Target: UNC5B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Apoptosis,Neuroscience,Cardiovascular. Shipping: Ice Bag
Western blot analysis of various lysates using UNC5B Rabbit pAb (A14978) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.