LTB4R Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15042
Artikelname: LTB4R Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15042
Hersteller Artikelnummer: A15042
Alternativnummer: ABB-A15042-20UL,ABB-A15042-100UL,ABB-A15042-1000UL,ABB-A15042-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BLT1, BLTR, P2Y7, GPR16, LTBR1, P2RY7, CMKRL1, LTB4R1, LTB4R
Predicted to enable G protein-coupled peptide receptor activity and leukotriene B4 receptor activity. Predicted to be involved in inflammatory response and neuropeptide signaling pathway. Predicted to act upstream of or within signal transduction. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane.
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 1241
UniProt: Q15722
Reinheit: Affinity purification
Sequenz: AAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Target-Kategorie: LTB4R
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Lipid Metabolism,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular,Blood,Heart,Cardiovascular diseases,Heart disease. Shipping: Ice Bag
Western blot analysis of various lysates using LTB4R Rabbit pAb (A15042) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.