LTB4R Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15042
Article Name: LTB4R Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15042
Supplier Catalog Number: A15042
Alternative Catalog Number: ABB-A15042-20UL,ABB-A15042-100UL,ABB-A15042-1000UL,ABB-A15042-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: BLT1, BLTR, P2Y7, GPR16, LTBR1, P2RY7, CMKRL1, LTB4R1, LTB4R
Predicted to enable G protein-coupled peptide receptor activity and leukotriene B4 receptor activity. Predicted to be involved in inflammatory response and neuropeptide signaling pathway. Predicted to act upstream of or within signal transduction. Predicted to be located in plasma membrane. Predicted to be integral component of plasma membrane.
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 1241
UniProt: Q15722
Purity: Affinity purification
Sequence: AAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Target: LTB4R
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Endocrine Metabolism,Lipid Metabolism,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular,Blood,Heart,Cardiovascular diseases,Heart disease. Shipping: Ice Bag
Western blot analysis of various lysates using LTB4R Rabbit pAb (A15042) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.