DLX5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15049
Artikelname: DLX5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15049
Hersteller Artikelnummer: A15049
Alternativnummer: ABB-A15049-20UL,ABB-A15049-100UL,ABB-A15049-500UL,ABB-A15049-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SHFM1, SHFM1D, DLX5
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 1749
UniProt: P56178
Reinheit: Affinity purification
Sequenz: EMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY
Target-Kategorie: DLX5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Neuroscience, Cell Type Marker,Stem Cells,Neural Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using DLX5 Rabbit pAb (A15049) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.