DLX5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15049
Article Name: DLX5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15049
Supplier Catalog Number: A15049
Alternative Catalog Number: ABB-A15049-20UL,ABB-A15049-100UL,ABB-A15049-500UL,ABB-A15049-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SHFM1, SHFM1D, DLX5
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 1749
UniProt: P56178
Purity: Affinity purification
Sequence: EMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY
Target: DLX5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Neuroscience, Cell Type Marker,Stem Cells,Neural Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using DLX5 Rabbit pAb (A15049) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.