SLC22A7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15137
Artikelname: SLC22A7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15137
Hersteller Artikelnummer: A15137
Alternativnummer: ABB-A15137-20UL,ABB-A15137-100UL,ABB-A15137-1000UL,ABB-A15137-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: NLT, OAT2, hOAT11, SLC22A7
The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 10864
UniProt: Q9Y694
Reinheit: Affinity purification
Sequenz: ALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQKG
Target-Kategorie: SLC22A7
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using SLC22A7 Rabbit pAb (A15137) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.