SLC22A7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15137
Article Name: SLC22A7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15137
Supplier Catalog Number: A15137
Alternative Catalog Number: ABB-A15137-20UL,ABB-A15137-100UL,ABB-A15137-1000UL,ABB-A15137-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NLT, OAT2, hOAT11, SLC22A7
The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 10864
UniProt: Q9Y694
Purity: Affinity purification
Sequence: ALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQKG
Target: SLC22A7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using SLC22A7 Rabbit pAb (A15137) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.