TRAM1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15142
Artikelname: TRAM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15142
Hersteller Artikelnummer: A15142
Alternativnummer: ABB-A15142-100UL,ABB-A15142-20UL,ABB-A15142-1000UL,ABB-A15142-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TRAM, PNAS8, TRAMP, TRAM1
This gene encodes a multi-pass membrane protein that is part of the mammalian endoplasmic reticulum. The encoded protein influences glycosylation and facilitates the translocation of secretory proteins across the endoplasmic reticulum membrane by regulating which domains of the nascent polypeptide chain are visible to the cytosol during a translocational pause.
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 23471
UniProt: Q15629
Reinheit: Affinity purification
Sequenz: CVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS
Target-Kategorie: TRAM1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Immunology Inflammation,Toll-like Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using TRAM1 Rabbit pAb (A15142) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.