TRAM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15142
Article Name: TRAM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15142
Supplier Catalog Number: A15142
Alternative Catalog Number: ABB-A15142-100UL,ABB-A15142-20UL,ABB-A15142-1000UL,ABB-A15142-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TRAM, PNAS8, TRAMP, TRAM1
This gene encodes a multi-pass membrane protein that is part of the mammalian endoplasmic reticulum. The encoded protein influences glycosylation and facilitates the translocation of secretory proteins across the endoplasmic reticulum membrane by regulating which domains of the nascent polypeptide chain are visible to the cytosol during a translocational pause.
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 23471
UniProt: Q15629
Purity: Affinity purification
Sequence: CVTQAFMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS
Target: TRAM1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Immunology Inflammation,Toll-like Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using TRAM1 Rabbit pAb (A15142) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.