PICK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1519
Artikelname: PICK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1519
Hersteller Artikelnummer: A1519
Alternativnummer: ABB-A1519-100UL,ABB-A1519-20UL,ABB-A1519-500UL,ABB-A1519-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PICK, PRKCABP, PICK1
The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 9463
UniProt: Q9NRD5
Reinheit: Affinity purification
Sequenz: CRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTR
Target-Kategorie: PICK1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using PICK1 Rabbit pAb (A1519) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.