PICK1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1519
Article Name: PICK1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1519
Supplier Catalog Number: A1519
Alternative Catalog Number: ABB-A1519-100UL,ABB-A1519-20UL,ABB-A1519-500UL,ABB-A1519-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PICK, PRKCABP, PICK1
The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 9463
UniProt: Q9NRD5
Purity: Affinity purification
Sequence: CRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTR
Target: PICK1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using PICK1 Rabbit pAb (A1519) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.