LIPH Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15215
Artikelname: LIPH Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15215
Hersteller Artikelnummer: A15215
Alternativnummer: ABB-A15215-100UL,ABB-A15215-20UL,ABB-A15215-1000UL,ABB-A15215-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AH, LAH2, ARWH2, HYPT7, LPDLR, PLA1B, mPA-PLA1, LIPH
This gene encodes a membrane-bound member of the mammalian triglyceride lipase family. It catalyzes the production of 2-acyl lysophosphatidic acid (LPA), which is a lipid mediator with diverse biological properties that include platelet aggregation, smooth muscle contraction, and stimulation of cell proliferation and motility.
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 200879
UniProt: Q8WWY8
Reinheit: Affinity purification
Sequenz: KLRDKAGNTTESKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGSLIGPRYKLRILRMKLRSLAHPERPQLCRYDLVLMENVETVFQPILCPELQ
Target-Kategorie: LIPH
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine Metabolism,Lipid Metabolism,Lipases,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates using LIPH Rabbit pAb (A15215) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.