LIPH Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15215
Article Name: LIPH Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15215
Supplier Catalog Number: A15215
Alternative Catalog Number: ABB-A15215-100UL,ABB-A15215-20UL,ABB-A15215-1000UL,ABB-A15215-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AH, LAH2, ARWH2, HYPT7, LPDLR, PLA1B, mPA-PLA1, LIPH
This gene encodes a membrane-bound member of the mammalian triglyceride lipase family. It catalyzes the production of 2-acyl lysophosphatidic acid (LPA), which is a lipid mediator with diverse biological properties that include platelet aggregation, smooth muscle contraction, and stimulation of cell proliferation and motility.
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 200879
UniProt: Q8WWY8
Purity: Affinity purification
Sequence: KLRDKAGNTTESKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGSLIGPRYKLRILRMKLRSLAHPERPQLCRYDLVLMENVETVFQPILCPELQ
Target: LIPH
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine Metabolism,Lipid Metabolism,Lipases,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates using LIPH Rabbit pAb (A15215) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.