GALK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15274
Artikelname: GALK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15274
Hersteller Artikelnummer: A15274
Alternativnummer: ABB-A15274-20UL,ABB-A15274-100UL,ABB-A15274-500UL,ABB-A15274-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GK1, GALK, HEL-S-19, GALK1
Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 2584
UniProt: P51570
Reinheit: Affinity purification
Sequenz: MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAA
Target-Kategorie: GALK1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle,Endocrine Metabolism,Carbohydrate metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using GALK1 Rabbit pAb (A15274) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60S.