GALK1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15274
Article Name: GALK1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15274
Supplier Catalog Number: A15274
Alternative Catalog Number: ABB-A15274-20UL,ABB-A15274-100UL,ABB-A15274-500UL,ABB-A15274-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GK1, GALK, HEL-S-19, GALK1
Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 2584
UniProt: P51570
Purity: Affinity purification
Sequence: MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAA
Target: GALK1
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle,Endocrine Metabolism,Carbohydrate metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using GALK1 Rabbit pAb (A15274) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60S.