Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15276
- Bilder (1)
| Artikelname: | Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15276 |
| Hersteller Artikelnummer: | A15276 |
| Alternativnummer: | ABB-A15276-20UL,ABB-A15276-100UL,ABB-A15276-1000UL,ABB-A15276-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B3, GC-S-beta-1, Guanylyl Cyclase beta 1 (GUCY1B3) |
| This gene encodes the beta subunit of the soluble guanylate cyclase (sGC), which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain, which serves as a receptor for ligands such as nitric oxide, oxygen and nitrovasodilator drugs. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 71kDa |
| NCBI: | 2983 |
| UniProt: | Q02153 |
| Reinheit: | Affinity purification |
| Sequenz: | MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSL |
| Target-Kategorie: | GUCY1B1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit pAb (A15276) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30S. |
Produktgarantie und fachkundiger Support
