Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15276
- Images (1)
| Article Name: | Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15276 |
| Supplier Catalog Number: | A15276 |
| Alternative Catalog Number: | ABB-A15276-20UL,ABB-A15276-100UL,ABB-A15276-1000UL,ABB-A15276-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B3, GC-S-beta-1, Guanylyl Cyclase beta 1 (GUCY1B3) |
| This gene encodes the beta subunit of the soluble guanylate cyclase (sGC), which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain, which serves as a receptor for ligands such as nitric oxide, oxygen and nitrovasodilator drugs. Alternative splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 71kDa |
| NCBI: | 2983 |
| UniProt: | Q02153 |
| Purity: | Affinity purification |
| Sequence: | MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSL |
| Target: | GUCY1B1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit pAb (A15276) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30S. |
Product Guarantee and Expert Support
