TCTA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15322
Artikelname: TCTA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15322
Hersteller Artikelnummer: A15322
Alternativnummer: ABB-A15322-20UL,ABB-A15322-100UL,ABB-A15322-500UL,ABB-A15322-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TCTA
Involved in negative regulation of osteoclast differentiation and osteoclast fusion. Predicted to be integral component of membrane.
Klonalität: Polyclonal
Molekulargewicht: 11kDa
NCBI: 6988
UniProt: P57738
Reinheit: Affinity purification
Sequenz: MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE
Target-Kategorie: TCTA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone. Shipping: Ice Bag
Western blot analysis of various lysates using TCTA Rabbit pAb (A15322) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.