TCTA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15322
Article Name: TCTA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15322
Supplier Catalog Number: A15322
Alternative Catalog Number: ABB-A15322-20UL,ABB-A15322-100UL,ABB-A15322-500UL,ABB-A15322-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TCTA
Involved in negative regulation of osteoclast differentiation and osteoclast fusion. Predicted to be integral component of membrane.
Clonality: Polyclonal
Molecular Weight: 11kDa
NCBI: 6988
UniProt: P57738
Purity: Affinity purification
Sequence: MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE
Target: TCTA
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone. Shipping: Ice Bag
Western blot analysis of various lysates using TCTA Rabbit pAb (A15322) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.