MPDZ Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15344
- Bilder (1)
| Artikelname: | MPDZ Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15344 |
| Hersteller Artikelnummer: | A15344 |
| Alternativnummer: | ABB-A15344-100UL,ABB-A15344-20UL,ABB-A15344-500UL,ABB-A15344-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HYC2, MUPP1, MPDZ |
| The protein encoded by this gene has multiple PDZ domains, which are hallmarks of protein-protein interactions. The encoded protein is known to interact with the HTR2C receptor and may cause it to clump at the cell surface. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 222kDa |
| NCBI: | 8777 |
| UniProt: | O75970 |
| Reinheit: | Affinity purification |
| Sequenz: | SLGQQSGRVMALDIFSSYTGRDIPELPEREEGEGEESELQNTAYSNWNQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLLHNLYPKYNFSSTNPFADSLQINADKAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGYSWKNIRERYGTLTGELHMIELE |
| Target-Kategorie: | MPDZ |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using MPDZ Rabbit pAb (A15344) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 2s. |
Produktgarantie und fachkundiger Support
