MPDZ Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15344
- Images (1)
| Article Name: | MPDZ Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15344 |
| Supplier Catalog Number: | A15344 |
| Alternative Catalog Number: | ABB-A15344-100UL,ABB-A15344-20UL,ABB-A15344-500UL,ABB-A15344-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | HYC2, MUPP1, MPDZ |
| The protein encoded by this gene has multiple PDZ domains, which are hallmarks of protein-protein interactions. The encoded protein is known to interact with the HTR2C receptor and may cause it to clump at the cell surface. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 222kDa |
| NCBI: | 8777 |
| UniProt: | O75970 |
| Purity: | Affinity purification |
| Sequence: | SLGQQSGRVMALDIFSSYTGRDIPELPEREEGEGEESELQNTAYSNWNQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLLHNLYPKYNFSSTNPFADSLQINADKAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGYSWKNIRERYGTLTGELHMIELE |
| Target: | MPDZ |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using MPDZ Rabbit pAb (A15344) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 2s. |
Product Guarantee and Expert Support
