CLIC3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15347
- Bilder (1)
| Artikelname: | CLIC3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15347 |
| Hersteller Artikelnummer: | A15347 |
| Alternativnummer: | ABB-A15347-100UL,ABB-A15347-20UL,ABB-A15347-500UL,ABB-A15347-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CLIC3 |
| Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 27kDa |
| NCBI: | 9022 |
| UniProt: | O95833 |
| Reinheit: | Affinity purification |
| Sequenz: | GPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR |
| Target-Kategorie: | CLIC3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CLIC3 Rabbit pAb (A15347) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
