CLIC3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15347
- Images (1)
| Article Name: | CLIC3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15347 |
| Supplier Catalog Number: | A15347 |
| Alternative Catalog Number: | ABB-A15347-100UL,ABB-A15347-20UL,ABB-A15347-500UL,ABB-A15347-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CLIC3 |
| Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. |
| Clonality: | Polyclonal |
| Molecular Weight: | 27kDa |
| NCBI: | 9022 |
| UniProt: | O95833 |
| Purity: | Affinity purification |
| Sequence: | GPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR |
| Target: | CLIC3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CLIC3 Rabbit pAb (A15347) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
