KIF20A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15377
- Bilder (1)
| Artikelname: | KIF20A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15377 |
| Hersteller Artikelnummer: | A15377 |
| Alternativnummer: | ABB-A15377-100UL,ABB-A15377-20UL,ABB-A15377-1000UL,ABB-A15377-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RCM6, MKLP2, RAB6KIFL, KIF20A |
| Enables protein kinase binding activity. Involved in microtubule bundle formation, midbody abscission, and regulation of cytokinesis. Located in several cellular components, including cleavage furrow, intercellular bridge, and midbody. Implicated in restrictive cardiomyopathy. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 100kDa |
| NCBI: | 10112 |
| UniProt: | O95235 |
| Reinheit: | Affinity purification |
| Sequenz: | EICNEMVEQMQQREQWCSEHLDTQKELLEEMYEEKLNILKESLTSFYQEEIQERDEKIEELEALLQEARQQSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCKAELNSTTEELHKYQKMLEPPPSAKPFTIDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHSTGAGKLRQALTTCDDILIKQDQTLAELQNNMVLVKLDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPNQQPPG |
| Target-Kategorie: | KIF20A |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cytoskeleton,Motor Proteins,Immunology Inflammation,Cytokines. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using KIF20A Rabbit pAb (A15377) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
Produktgarantie und fachkundiger Support
