KIF20A Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15377
- Images (1)
| Article Name: | KIF20A Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15377 |
| Supplier Catalog Number: | A15377 |
| Alternative Catalog Number: | ABB-A15377-100UL,ABB-A15377-20UL,ABB-A15377-1000UL,ABB-A15377-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | RCM6, MKLP2, RAB6KIFL, KIF20A |
| Enables protein kinase binding activity. Involved in microtubule bundle formation, midbody abscission, and regulation of cytokinesis. Located in several cellular components, including cleavage furrow, intercellular bridge, and midbody. Implicated in restrictive cardiomyopathy. |
| Clonality: | Polyclonal |
| Molecular Weight: | 100kDa |
| NCBI: | 10112 |
| UniProt: | O95235 |
| Purity: | Affinity purification |
| Sequence: | EICNEMVEQMQQREQWCSEHLDTQKELLEEMYEEKLNILKESLTSFYQEEIQERDEKIEELEALLQEARQQSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCKAELNSTTEELHKYQKMLEPPPSAKPFTIDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHSTGAGKLRQALTTCDDILIKQDQTLAELQNNMVLVKLDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPNQQPPG |
| Target: | KIF20A |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cytoskeleton,Motor Proteins,Immunology Inflammation,Cytokines. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using KIF20A Rabbit pAb (A15377) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
Product Guarantee and Expert Support
