OLFM4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15387
- Bilder (1)
| Artikelname: | OLFM4 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15387 |
| Hersteller Artikelnummer: | A15387 |
| Alternativnummer: | ABB-A15387-100UL,ABB-A15387-20UL,ABB-A15387-500UL,ABB-A15387-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GC1, OLM4, OlfD, GW112, hGC-1, hOLfD, UNQ362, bA209J19.1, OLFM4 |
| This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. This gene encodes a member of the olfactomedin family. The encoded protein is an antiapoptotic factor that promotes tumor growth and is an extracellular matrix glycoprotein that facilitates cell adhesion. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 57kDa |
| NCBI: | 10562 |
| UniProt: | Q6UX06 |
| Reinheit: | Affinity purification |
| Sequenz: | AIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSPQHPNKGLYWVAPLNTDGRLLEYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNTGNIARVNLTTNTIAVTQTLPNAAYNNRFSYANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNTWYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEG |
| Target-Kategorie: | OLFM4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000 |ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using OLFM4 Rabbit pAb (A15387) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s. |
Produktgarantie und fachkundiger Support
