OLFM4 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15387
- Images (1)
| Article Name: | OLFM4 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15387 |
| Supplier Catalog Number: | A15387 |
| Alternative Catalog Number: | ABB-A15387-100UL,ABB-A15387-20UL,ABB-A15387-500UL,ABB-A15387-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GC1, OLM4, OlfD, GW112, hGC-1, hOLfD, UNQ362, bA209J19.1, OLFM4 |
| This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. This gene encodes a member of the olfactomedin family. The encoded protein is an antiapoptotic factor that promotes tumor growth and is an extracellular matrix glycoprotein that facilitates cell adhesion. |
| Clonality: | Polyclonal |
| Molecular Weight: | 57kDa |
| NCBI: | 10562 |
| UniProt: | Q6UX06 |
| Purity: | Affinity purification |
| Sequence: | AIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSPQHPNKGLYWVAPLNTDGRLLEYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNTGNIARVNLTTNTIAVTQTLPNAAYNNRFSYANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNTWYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEG |
| Target: | OLFM4 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000 |ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using OLFM4 Rabbit pAb (A15387) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s. |
Product Guarantee and Expert Support
