TRNAU1AP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15459
Artikelname: TRNAU1AP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15459
Hersteller Artikelnummer: A15459
Alternativnummer: ABB-A15459-20UL,ABB-A15459-100UL,ABB-A15459-1000UL,ABB-A15459-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SECP43, PRO1902, TRSPAP1, TRNAU1AP
Enables RNA binding activity. Predicted to be involved in selenocysteine incorporation. Predicted to be located in cytoplasm. Predicted to be active in nucleus.
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 54952
UniProt: Q9NX07
Reinheit: Affinity purification
Sequenz: MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANK
Target-Kategorie: TRNAU1AP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag
Western blot analysis of various lysates using TRNAU1AP Rabbit pAb (A15459) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 2s.