TRNAU1AP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15459
Article Name: TRNAU1AP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15459
Supplier Catalog Number: A15459
Alternative Catalog Number: ABB-A15459-20UL,ABB-A15459-100UL,ABB-A15459-1000UL,ABB-A15459-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SECP43, PRO1902, TRSPAP1, TRNAU1AP
Enables RNA binding activity. Predicted to be involved in selenocysteine incorporation. Predicted to be located in cytoplasm. Predicted to be active in nucleus.
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 54952
UniProt: Q9NX07
Purity: Affinity purification
Sequence: MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANK
Target: TRNAU1AP
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag
Western blot analysis of various lysates using TRNAU1AP Rabbit pAb (A15459) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 2s.