PGM2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15467
- Bilder (1)
| Artikelname: | PGM2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15467 |
| Hersteller Artikelnummer: | A15467 |
| Alternativnummer: | ABB-A15467-20UL,ABB-A15467-100UL,ABB-A15467-1000UL,ABB-A15467-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MSTP006, PGM2 |
| Enables phosphopentomutase activity. Predicted to be involved in carbohydrate metabolic process and deoxyribose phosphate catabolic process. Predicted to act upstream of or within glucose metabolic process. Located in extracellular exosome. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 68kDa |
| NCBI: | 55276 |
| UniProt: | Q96G03 |
| Reinheit: | Affinity purification |
| Sequenz: | MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFIS |
| Target-Kategorie: | PGM2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PGM2 Rabbit pAb (A15467) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
