PGM2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15467
Article Name: PGM2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15467
Supplier Catalog Number: A15467
Alternative Catalog Number: ABB-A15467-20UL,ABB-A15467-100UL,ABB-A15467-1000UL,ABB-A15467-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MSTP006, PGM2
Enables phosphopentomutase activity. Predicted to be involved in carbohydrate metabolic process and deoxyribose phosphate catabolic process. Predicted to act upstream of or within glucose metabolic process. Located in extracellular exosome.
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 55276
UniProt: Q96G03
Purity: Affinity purification
Sequence: MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFIS
Target: PGM2
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using PGM2 Rabbit pAb (A15467) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.