ZNF331 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15470
Artikelname: ZNF331 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15470
Hersteller Artikelnummer: A15470
Alternativnummer: ABB-A15470-100UL,ABB-A15470-20UL,ABB-A15470-1000UL,ABB-A15470-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RITA, ZNF361, ZNF463, ZNF331
This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptional repressors. This gene may be methylated and silenced in cancer cells. This gene is located within a differentially methylated region (DMR) and shows allele-specific expression in placenta. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding the same protein.
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 55422
UniProt: Q9NQX6
Reinheit: Affinity purification
Sequenz: AYENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENS
Target-Kategorie: ZNF331
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates, using ZNF331 Rabbit pAb (A15470) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.