ZNF331 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A15470
Article Name: ZNF331 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A15470
Supplier Catalog Number: A15470
Alternative Catalog Number: ABB-A15470-100UL,ABB-A15470-20UL,ABB-A15470-1000UL,ABB-A15470-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RITA, ZNF361, ZNF463, ZNF331
This gene encodes a zinc finger protein containing a KRAB (Kruppel-associated box) domain found in transcriptional repressors. This gene may be methylated and silenced in cancer cells. This gene is located within a differentially methylated region (DMR) and shows allele-specific expression in placenta. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding the same protein.
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 55422
UniProt: Q9NQX6
Purity: Affinity purification
Sequence: AYENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENS
Target: ZNF331
Antibody Type: Primary Antibody
Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates, using ZNF331 Rabbit pAb (A15470) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.