CDK5RAP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15476
- Bilder (1)
| Artikelname: | CDK5RAP2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15476 |
| Hersteller Artikelnummer: | A15476 |
| Alternativnummer: | ABB-A15476-100UL,ABB-A15476-20UL,ABB-A15476-500UL,ABB-A15476-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C48, MCPH3, Cep215, CDK5RAP2 |
| This gene encodes a regulator of CDK5 (cyclin-dependent kinase 5) activity. The protein encoded by this gene is localized to the centrosome and Golgi complex, interacts with CDK5R1 and pericentrin (PCNT), plays a role in centriole engagement and microtubule nucleation, and has been linked to primary microcephaly and Alzheimers disease. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 215kDa |
| NCBI: | 55755 |
| UniProt: | Q96SN8 |
| Reinheit: | Affinity purification |
| Sequenz: | GQRLLAEMDIQTQEAPSSTSQELGTKGPHPAPLSKFVSSVSTAKLTLEEAYRRLKLLWRVSLPEDGQCPLHCEQIGEMKAEVTKLHKKLFEQEKKLQNTMKLLQLSKRQEKVIFDQLVVTHKILRKARGNLELRPGGAHPGTCSPSRPGS |
| Target-Kategorie: | CDK5RAP2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Microtubules,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CDK5RAP2 Rabbit pAb (A15476) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
