CDK5RAP2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A15476
- Images (1)
| Article Name: | CDK5RAP2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A15476 |
| Supplier Catalog Number: | A15476 |
| Alternative Catalog Number: | ABB-A15476-100UL,ABB-A15476-20UL,ABB-A15476-500UL,ABB-A15476-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | C48, MCPH3, Cep215, CDK5RAP2 |
| This gene encodes a regulator of CDK5 (cyclin-dependent kinase 5) activity. The protein encoded by this gene is localized to the centrosome and Golgi complex, interacts with CDK5R1 and pericentrin (PCNT), plays a role in centriole engagement and microtubule nucleation, and has been linked to primary microcephaly and Alzheimers disease. Alternative splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 215kDa |
| NCBI: | 55755 |
| UniProt: | Q96SN8 |
| Purity: | Affinity purification |
| Sequence: | GQRLLAEMDIQTQEAPSSTSQELGTKGPHPAPLSKFVSSVSTAKLTLEEAYRRLKLLWRVSLPEDGQCPLHCEQIGEMKAEVTKLHKKLFEQEKKLQNTMKLLQLSKRQEKVIFDQLVVTHKILRKARGNLELRPGGAHPGTCSPSRPGS |
| Target: | CDK5RAP2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Microtubules,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CDK5RAP2 Rabbit pAb (A15476) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s. |
Product Guarantee and Expert Support
